Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GATA
Protein Properties Length: 310aa    MW: 34739.3 Da    PI: 7.439
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                                     C++C ++kTp+WR gp g+ktLCnaCG+++++ +l 242 CAHCMSSKTPQWRAGPLGPKTLCNACGVRFKSGRL 276
                                     *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004010.05154206IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.75E-5157190No hitNo description
Gene3DG3DSA: finger, NHR/GATA-type
SMARTSM004012.1E-14236290IPR000679Zinc finger, GATA-type
PROSITE profilePS5011410.91240272IPR000679Zinc finger, GATA-type
Gene3DG3DSA: finger, NHR/GATA-type
SuperFamilySSF577161.14E-13240299No hitNo description
CDDcd002022.28E-12241298No hitNo description
PROSITE patternPS003440242267IPR000679Zinc finger, GATA-type
PfamPF003205.1E-16242276IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963249.11e-120PREDICTED: GATA transcription factor 2-like
TrEMBLA0A0A8XNM81e-129A0A0A8XNM8_ARUDO; Uncharacterized protein
STRINGSi022727m1e-120(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.12e-33GATA transcription factor 7